Overview

Description

  • Nature
    Recombinant
  • Source
    CHO cells
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNRE WTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFR KNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLK SFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANL VVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPV AQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTT PAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQE
    • Molecular weight
      37 kDa
    • Amino acids
      20 to 357
    • Additional sequence information
      Extracellular domain, fused to the N-terminus of the Fc region of mouse IgG2a. (CAA37810.1).

Specifications

Our Abpromise guarantee covers the use of ab214975 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELISA.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.060 Eu/µg
  • Purity
    >= 98 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.

    Constituent: 99% PBS

    Lyophilized from 0.2 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute at 100 µg/mL in sterile PBS. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names
    • CD 126
    • CD126
    • CD126 antigen
    • gp80
    • IL 6R
    • IL 6R 1
    • IL 6R alpha
    • IL-6 receptor alpha chain
    • IL-6 receptor subunit alpha
    • IL-6R 1
    • IL-6R subunit alpha
    • IL-6R-alpha
    • IL-6RA
    • IL6Q
    • Il6r
    • IL6RA
    • IL6RA_HUMAN
    • IL6RQ
    • Interleukin 6 receptor
    • interleukin 6 receptor, alpha
    • Interleukin-6 receptor subunit alpha
    • Membrane glycoprotein 80
    • MGC30256
    see all
  • Function
    Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis.
    Low concentration of a soluble form of IL6 receptor acts as an agonist of IL6 activity.
  • Tissue specificity
    Isoform 2 is expressed in peripheral blood mononuclear cells and weakly found in urine and serum.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 3 subfamily.
    Contains 1 fibronectin type-III domain.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Domain
    The two fibronectin type-III-like domains, contained in the N-terminal part, form together a cytokine-binding domain.
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
  • Post-translational
    modifications
    A short soluble form may also be released from the membrane by proteolysis.
  • Cellular localization
    Secreted and Basolateral cell membrane.
  • Information by UniProt

References

ab214975 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214975.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up