Recombinant mouse IL-7 protein (ab9733)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant mouse IL-7 protein
See all IL-7 proteins and peptides -
Purity
> 98 % SDS-PAGE.
Sterile filtered Greater than 98% pure by HPLC analyses. Endotoxin level is less than 0.1 ng per g (1EU/g). -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDT KEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNV KEQKKNDACFLKRLLREIKTCWNKILKGSI -
Predicted molecular weight
20 kDa -
Amino acids
26 to 154
-
Specifications
Our Abpromise guarantee covers the use of ab9733 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
The ED50, determined by the dose-dependent stimulation of the proliferation of murine IXN/2B cells, is < 0.2 ng/ml, corresponding to a specific activity of > 5 x 106 units/mg. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionFor lot specific reconstitution information please contact our Scientific Support Team.
General Info
-
Alternative names
- IL 7
- IL-7
- Il7
see all -
Function
Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. -
Sequence similarities
Belongs to the IL-7/IL-9 family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab9733 has been referenced in 1 publication.
- Cao L et al. Deregulation of tumor suppressive ASXL1-PTEN/AKT axis in myeloid malignancies. J Mol Cell Biol 12:688-699 (2020). PubMed: 32236560