Description

  • Product name

    Recombinant mouse IL-7 protein (Active)
    See all IL-7 proteins and peptides
  • Biological activity

    2E8 cell proliferation ≤1 ng/mL; ≥ 1.0 x 10^6 units/mg.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    <=1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDT KEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNV KEQKKNDACFLKRLLREIKTCWNKILKGSI
    • Predicted molecular weight

      15 kDa
    • Amino acids

      26 to 154
    • Additional sequence information

      Full length mature chain without signal peptide. Source: Genetically modified E.coli.

Specifications

Our Abpromise guarantee covers the use of ab238301 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    12 months from date of receipt when stored at -20°C to -80°C as supplied.
    1 month when stored at 4°C after reconstituting as directed.
    3 months when stored at -20°C to -80°C after reconstituting as directed.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituent: 0.1% Trifluoroacetic acid

    Lyophilized from a sterile (0.2 micron) filtered aqueous solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Sterile 10 mM acetic acid at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • IL 7
    • IL-7
    • Il7
    • IL7_HUMAN
    • Interleukin 7
    • Interleukin-7
    • LP-1
    • Lymphopoietin 1
    see all
  • Function

    Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
  • Sequence similarities

    Belongs to the IL-7/IL-9 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 2E8 cell proliferation ≤1 ng/mL; ≥ 1.0 x 10^6 units/mg.

  • Recombinant mouse IL7 protein (Active) (ab238301) used at 1 µg.

    4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

References

ab238301 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238301.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up