Description

  • Product name

    Recombinant mouse IL-9 protein (Active)
    See all IL-9 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine TS1 cells is less than 0.02 ng/ml, corresponding to a specific activity of >5.0 x 107 IU/mg.

  • Purity

    > 97 % SDS-PAGE.
    > 97 % by HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPC YREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMA GNTLSFLKSLLGTFQKTEMQRQKSRP
    • Predicted molecular weight

      14 kDa
    • Amino acids

      19 to 144
    • Additional sequence information

      This product is the mature full length protein from aa 19 to 144. The signal peptide is not included.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab243166 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    0.2 micron filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Cytokine P40
    • Homolog of mouse T cell and mast cell growth factor 40
    • HP40
    • IL 9
    • IL-9
    • Il9
    • IL9_HUMAN
    • Interleukin 9
    • Interleukin-9
    • Mast cell growth factor
    • MCGF
    • Megakaryoblast growth factor
    • P40
    • p40 cytokine
    • p40 T cell and mast cell growth factor
    • T cell growth factor 3
    • T cell growth factor p40
    • T-cell growth factor P40
    • TCGF 3
    see all
  • Function

    Supports IL-2 independent and IL-4 independent growth of helper T-cells.
  • Sequence similarities

    Belongs to the IL-7/IL-9 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab243166.

References

ab243166 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243166.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up