Recombinant Mouse IL1 Receptor I/IL-1R-1 protein (Fc Chimera) (ab215598)

Description

  • Product name

    Recombinant Mouse IL1 Receptor I/IL-1R-1 protein (Fc Chimera)
    See all IL1 Receptor I/IL-1R-1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPI SADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLEN DPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKP LLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFI TIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSE IEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKN TNIFESAHVQLIYPVPDFKIEGRDMDPKSCDKTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK
    • Predicted molecular weight

      64 kDa including tags
    • Amino acids

      20 to 338
    • Additional sequence information

      Fc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab215598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as IL1 Receptor I. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution.

  • Reconstitution
    Dissolve the lyophilized protein in ddH2O. It is not recommended to reconstitute to a concentration less than 100 µg/ml.

General Info

  • Alternative names

    • Antigen CD121a
    • CD121 antigen-like family member A
    • CD121a
    • CD121a antigen
    • D2S1473
    • IL 1
    • IL 1R 1
    • IL 1R alpha
    • IL 1RT1
    • IL-1R-1
    • IL-1R-alpha
    • IL-1RT-1
    • IL-1RT1
    • IL1 inhibitor
    • IL1 Receptor I
    • IL1R
    • IL1R1
    • IL1R1_HUMAN
    • IL1RA
    • IL1RN
    • IL1RT1
    • Interleukin 1 receptor alpha type 1
    • Interleukin 1 receptor antagonist protein (IRAP)
    • Interleukin 1 receptor type I
    • Interleukin receptor 1
    • Interleukin-1 receptor alpha
    • Interleukin-1 receptor type 1
    • Interleukin-1 receptor type I
    • p80
    see all
  • Function

    Receptor for interleukin-1 alpha (IL-1A), beta (IL-1B), and interleukin-1 receptor antagonist protein (IL-1RA). Binding to the agonist leads to the activation of NF-kappa-B. Signaling involves formation of a ternary complex containing IL1RAP, TOLLIP, MYD88, and IRAK1 or IRAK2.
  • Sequence similarities

    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 TIR domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab215598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up