Recombinant Mouse IL2 Receptor beta/p75 protein (His tag) (ab226879)

Description

  • Product name

    Recombinant Mouse IL2 Receptor beta/p75 protein (His tag)
    See all IL2 Receptor beta/p75 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCEL TLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFH PFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLG HSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQ PLTFRTRPADPMKE
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      27 to 240
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab226879 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as IL2 Receptor beta

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • CD122
    • CD122 antigen
    • High affinity IL 2 receptor beta subunit
    • High affinity IL 2 receptor subunit beta
    • High affinity IL-2 receptor subunit beta
    • IL-2 receptor subunit beta
    • IL-2R subunit beta
    • IL-2RB
    • IL15RB
    • IL2 receptor
    • IL2RB
    • IL2RB_HUMAN
    • Interleukin 2 receptor beta
    • Interleukin-2 receptor subunit beta
    • P70 75
    • P70-75
    • P7075
    • p75
    see all
  • Function

    Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 1 fibronectin type-III domain.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226879 with 5% enrichment gel and 15% separation gel.

References

ab226879 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226879.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up