Description

  • Product name

    Recombinant Mouse IL36 alpha/IL-1F6 protein
    See all IL36 alpha/IL-1F6 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMNKEKELRAASPSLRHVQDLSSRVWIL QNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLF CTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPG WFIAVCSKGSCPLILTQELGEIFITDFEMIVVH
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      1 to 160
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_062323.

Specifications

Our Abpromise guarantee covers the use of ab207104 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Previously labelled as IL36 alpha. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • FIL1
    • FIL1 epsilon
    • FIL1(EPSILON)
    • FIL1E
    • IL 1 epsilon
    • IL 1F6
    • IL 1H1
    • IL-1 epsilon
    • IL-1F6
    • IL1E
    • IL1F6
    • IL1F6_HUMAN
    • IL1RP2
    • IL36 alpha
    • IL36A
    • Interleukin 1 epsilon
    • Interleukin 1 family member 6
    • Interleukin 1 family member 6 (epsilon)
    • Interleukin 36 alpha
    • Interleukin-1 epsilon
    • Interleukin-1 family member 6
    • MGC129552
    • MGC129553
    • MGC151479
    • MGC151481
    • OTTMUSP00000012798
    • RP23-176J12.4
    see all
  • Tissue specificity

    Expressed in immune system and fetal brain, but not in other tissues tested or in multiple hematopoietic cell lines.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab207104 (3µg).

References

ab207104 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207104.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up