Recombinant mouse IL36 beta/IL-1F8 protein (Active) (ab241515)
Key features and details
- Expression system: Escherichia coli
- Purity: > 97% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, HPLC
Description
-
Product name
Recombinant mouse IL36 beta/IL-1F8 protein (Active)
See all IL36 beta/IL-1F8 proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion in murine NIH/3T3 cells is less than 10 ng/ml, corresponding to a specific activity of >1.0x105 IU/mg.
-
Purity
> 97 % SDS-PAGE.
> 97 % by HPLC. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
SSQSPRNYRVHDSQQMVWVLTGNTLTAVPASNNVKPVILSLIACRDTEFQ DVKKGNLVFLGIKNRNLCFCCVEMEGKPTLQLKEVDIMNLYKERKAQKAF LFYHGIEGSTSVFQSVLYPGWFIATSSIERQTIILTHQRGKLVNTNFYIE SEK -
Predicted molecular weight
17 kDa -
Amino acids
31 to 183 -
Additional sequence information
This product is the mature full length protein from aa 31 to 183. The propeptide is not included.
-
Specifications
Our Abpromise guarantee covers the use of ab241515 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: PBS, 5% Trehalose
0.2 µm filtered.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at = -20 °C. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- 2310043N20Rik
- Family of interleukin 1 eta
- FIL1
see all -
Tissue specificity
Expression at low levels in tonsil, bone marrow, heart, placenta, lung, testis and colon but not in other tissues or in any hematopoietic cell lines. -
Sequence similarities
Belongs to the IL-1 family. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab241515 has not yet been referenced specifically in any publications.