Recombinant Mouse IL36 gamma/IL-1F9 protein (Animal Free) (ab219124)

Description

  • Product name

    Recombinant Mouse IL36 gamma/IL-1F9 protein (Animal Free)
    See all IL36 gamma/IL-1F9 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity determined by reducing and non-reducing SDS-PAGE.
  • Endotoxin level

    <=1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPES LEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKP FLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLD IKS
    • Predicted molecular weight

      18 kDa
    • Amino acids

      13 to 164

Specifications

Our Abpromise guarantee covers the use of ab219124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as IL36 gamma. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

  • Reconstitution
    Reconstitute in sterile 10 mM HCI at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • IL 1 epsilon
    • IL 1 related protein 2
    • IL 1(EPSILON)
    • IL 1F9
    • IL 1H1
    • IL 1RP2
    • IL-1 epsilon
    • IL-1-related protein 2
    • IL-1F9
    • IL-1H1
    • IL-1RP2
    • IL1E
    • Il1f9
    • IL1F9_HUMAN
    • IL1H1
    • IL1RP2
    • IL36 gamma
    • IL36G
    • Interleukin 1 epsilon
    • Interleukin 1 family member 9
    • Interleukin 1 homolog 1
    • Interleukin 1 related protein 2
    • Interleukin 36 gamma
    • Interleukin-1 epsilon
    • Interleukin-1 family member 9
    • Interleukin-1 homolog 1
    see all
  • Function

    Function as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2. Could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), that is present in epithelial barriers and takes part in local inflammatory response.
  • Tissue specificity

    Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional psoriasis skin.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 4-20% Tris-Glycine SDS-PAGE analysis of 1 µg ab219124, stained with Coomasie blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

References

ab219124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up