Description

  • Product name

    Recombinant Mouse Kallikrein 14 protein (Tagged)
    See all Kallikrein 14 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILH VALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLG RAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQA CHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMER CAMPGYPGVYANLCNYHSWIQRTMQSN
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      24 to 250
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full-length mature chain lacking the signal peptide and pro-peptide. N-terminal 6xHis-SUMO-tagged.

Specifications

Our Abpromise guarantee covers the use of ab239444 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • hK14
    • Kallikrein 14
    • Kallikrein like protein 6
    • Kallikrein-14
    • Kallikrein-like protein 6
    • KLK L6
    • KLK-L6
    • KLK14
    • KLK14_HUMAN
    see all
  • Function

    Serine-type endopeptidase with a dual trypsin-like and chymotrypsin-like substrate specificity. May activate/inactivate the proteinase-activated receptors F2R, F2RL1 and F2RL3 and other kallikreins including KLK1, KLK3, KLK5 and KLK11. May function in seminal clot liquefaction through direct cleavage of the semenogelin SEMG1 and SEMG2 and activation of KLK3. May function through desmoglein DSG1 cleavage in epidermal desquamation a process by which the most superficial corneocytes are shed from the skin surface. May be involved in several aspects of tumor progression including growth, invasion and angiogenesis.
  • Tissue specificity

    Highly expressed in CNS, bone marrow and fetal liver. Also expressed in breast, thyroid, kidney, colon, pancreas, spleen, prostate, uterus, small intestine, placenta and skeletal muscle. Among 40 tissues tested, the highest expression is detected in skin followed by breast and prostate (at protein level). Expressed in stratum corneum by sweat ducts and sweat glands and detected in sweat (at protein level).
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    Proteolytic cleavage of the activation peptide produces the active enzyme.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt

Images

  • ab239444 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab239444 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239444.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up