Recombinant Mouse Kallikrein 8/KLK8 protein (His tag) (ab223010)
Key features and details
- Expression system: Baculovirus infected insect cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Mouse Kallikrein 8/KLK8 protein (His tag)
See all Kallikrein 8/KLK8 proteins and peptides -
Purity
> 95 % SDS-PAGE.
Affinity purified -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Baculovirus infected insect cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
QGSKILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQK YSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQN SANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKI YSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSW GSDPCGKPEKPGVYTKICRYTTWIKKTMDNRDLEHHHHHH -
Predicted molecular weight
27 kDa including tags -
Amino acids
29 to 260 -
Tags
His tag C-Terminus -
Additional sequence information
Full-length protein lacking the signal peptide.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab223010 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Additional notes
This product was previously labelled as Kallikrein 8
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: PBS, 10% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- Brain serine protease 1
- BSP1
- hK8
see all -
Function
Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury. -
Tissue specificity
Isoform 1 is predominantly expressed in the pancreas. Isoform 2 is expressed in adult brain and hippocampus. Isoform 1 and isoform 2 are found in fetal brain and placenta. Detected in salivary gland, uterus, thymus, breast, testis and kidney but not in spleen, liver, lung or normal ovarian tissue. Displays an 11.5-fold increase in Alzheimer disease hippocampus compared to controls and is overexpressed in some ovarian carcinomas. Expressed at low levels in normal skin while high levels are found in psoriasis vulgaris, seborrheic keratosis, lichen planus and squamous cell carcinoma skin samples. Expressed in the keratinocytes. -
Sequence similarities
Belongs to the peptidase S1 family. Kallikrein subfamily.
Contains 1 peptidase S1 domain. -
Cellular localization
Secreted. Cytoplasm. Shows a cytoplasmic distribution in the keratinocytes. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab223010 has not yet been referenced specifically in any publications.