Description

  • Product name

    Recombinant Mouse Kallikrein 8/KLK8 protein (His tag)
    See all Kallikrein 8/KLK8 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVR LGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANL GDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQN KCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDP CGKPEKPGVYTKICRYTTWIKKTMDNRD
    • Predicted molecular weight

      29 kDa including tags
    • Amino acids

      33 to 260
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full length mature chain without the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab238388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Kallikrein 8

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Brain serine protease 1
    • BSP1
    • hK8
    • HNP
    • HPN
    • Kallikrein 8 (neuropsin/ovasin)
    • Kallikrein related peptidase 8
    • Kallikrein-8
    • Kallikrein8
    • KLK 8
    • Klk8
    • KLK8 protein type 1
    • KLK8 protein type 2
    • KLK8_HUMAN
    • Neuropsin
    • neuropsin type 1
    • Neuropsin type 1, included
    • Neuropsin type 2
    • Neuropsin type 2, included
    • Neuropsin, mouse, homolog of
    • NP
    • NRPN
    • Ovasin
    • PRO322
    • Protease serine 19
    • PRSS 19
    • PRSS19
    • Serine protease 19
    • Serine protease kallikrein
    • Serine protease kallikrein/ovasin/neuropsin
    • Serine protease TADG 14
    • Serine protease TADG-14
    • Serine protease TADG14
    • TADG 14
    • TADG14
    • Tumor associated differentially expressed gene 14
    • Tumor associated differentially expressed gene 14 protein
    • Tumor-associated differentially expressed gene 14 protein
    • UNQ283
    see all
  • Function

    Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury.
  • Tissue specificity

    Isoform 1 is predominantly expressed in the pancreas. Isoform 2 is expressed in adult brain and hippocampus. Isoform 1 and isoform 2 are found in fetal brain and placenta. Detected in salivary gland, uterus, thymus, breast, testis and kidney but not in spleen, liver, lung or normal ovarian tissue. Displays an 11.5-fold increase in Alzheimer disease hippocampus compared to controls and is overexpressed in some ovarian carcinomas. Expressed at low levels in normal skin while high levels are found in psoriasis vulgaris, seborrheic keratosis, lichen planus and squamous cell carcinoma skin samples. Expressed in the keratinocytes.
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted. Cytoplasm. Shows a cytoplasmic distribution in the keratinocytes.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel of ab238388.

References

ab238388 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up