Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MEPATTLPPGPRPALPLGGPGPLGEFLPPPECPVFEPSWEEFADPFAFIH KIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVK LNFLDQIAKYWELQGSTLKIPHVERKILDLFQLNKLVAEEGGFAVVCKDR KWTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSGDSLRCLQKPNLT SDTKDKEYKPHDIPQRQSVQPAETCPPARRAKRMRAEAMNIKIEPEEATE ARTHNLRRRMGCTTPKWENEKEMKSTIKQEPTEKKDCELESEKEKPKSRA KKTATAVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLVPPLHDVPKGD WRCPKCLAQECNKPQEAFGFEQAARDYTLRTFGEMADAFKSDYFNMPVHM VPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGKIKISPE EEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHI EDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLH QLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAV NFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVAST VQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCIKCKTTCF MSAISCSCKPGLLVCLHHVKELCSCPPYKYNLRYRYTLDDLYPMMNALKL RAE
    • Molecular weight

      112 kDa including tags
    • Amino acids

      1 to 753
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139634 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity

    >= 90 % Densitometry.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names

    • JHDM3B
    • JmjC domain-containing histone demethylation protein 3B
    • JMJD2B
    • Jumonji domain containing 2B
    • Jumonji domain containing protein 2B
    • Jumonji domain-containing protein 2B
    • Kdm4b
    • KDM4B_HUMAN
    • KIAA0876
    • Lysine (K) specific demethylase 4B
    • Lysine demethylase 4B
    • Lysine-specific demethylase 4B
    • TDRD14B
    • Tudor domain containing 14B
    see all
  • Function

    Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27', H3 'Lys-36' nor H4 'Lys-20'. Only able to demethylate trimethylated H3 'Lys-9', with a weaker activity than KDM4A, KDM4C and KDM4D. Demethylation of Lys residue generates formaldehyde and succinate.
  • Sequence similarities

    Belongs to the JHDM3 histone demethylase family.
    Contains 1 JmjC domain.
    Contains 1 JmjN domain.
    Contains 2 PHD-type zinc fingers.
    Contains 2 Tudor domains.
  • Domain

    The 2 Tudor domains recognize and bind methylated histones. Double Tudor domain has an interdigitated structure and the unusual fold is required for its ability to bind methylated histone tails.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE - Recombinant Mouse KDM4B / JMJD2B protein (Tagged) (ab139634)

References

ab139634 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139634.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up