Description

  • Product name

    Recombinant mouse KGF protein (Active)
    See all KGF proteins and peptides
  • Biological activity

    The biological activity was determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing KGF receptors yielding an ED50 <10ng/mL, corresponding to a Specific Activity of 1.0 x 105 IU/mg.

  • Purity

    > 96 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MCNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRID KRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAK KECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTK KEQKTAHFLPMAIT
    • Predicted molecular weight

      19 kDa
    • Amino acids

      32 to 194
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included. A single non-glycosylated polypeptide chain.

Specifications

Our Abpromise guarantee covers the use of ab200290 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 94% Phosphate Buffer, 5.8% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.

General Info

  • Alternative names

    • FGF 7
    • FGF-7
    • Fgf7
    • FGF7_HUMAN
    • Fibroblast growth factor 7
    • HBGF 7
    • HBGF-7
    • HBGF7
    • Heparin binding growth factor 7
    • Heparin-binding growth factor 7
    • Keratinocyte growth factor
    • KGF
    see all
  • Function

    Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.
  • Tissue specificity

    Epithelial cell.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab200290 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200290.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up