Bioactive grade

Recombinant mouse Lactate Dehydrogenase B/LDH-B protein (Active) (ab223027)

Description

  • Product name

    Recombinant mouse Lactate Dehydrogenase B/LDH-B protein (Active)
    See all Lactate Dehydrogenase B/LDH-B proteins and peptides
  • Biological activity

    Specific activity is >150 units/mg, in which one unit will convert 1.0 µmole of pyruvate to L-lactate and beta-NAD per minute at pH 7.5.

  • Purity

    > 95 % SDS-PAGE.
    ab223027 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMATLKEKLIASVADDEAAVPNNKITVV GVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPK IVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVK YSPDCTIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAE KLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSEN WKEVHKMVVDSAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTM VKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLRKSADTLWDI QKDLKDL
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      1 to 334
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_032518.

Specifications

Our Abpromise guarantee covers the use of ab223027 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Previously labelled as Lactate Dehydrogenase B.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 10% Glycerol, 0.32% Tris HCl

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Epididymis secretory protein Li 281
    • HEL S 281
    • L lactate dehydrogenase B chain
    • L-lactate dehydrogenase B chain
    • Lactate Dehydrogenase B
    • Lactate dehydrogenase H chain
    • LDH B
    • LDH H
    • LDH heart subunit
    • LDH-B
    • LDH-H
    • LDHB
    • LDHB_HUMAN
    • LDHBD
    • LDHH
    • Renal carcinoma antigen NY REN 46
    • Renal carcinoma antigen NY-REN-46
    • TRG-5
    • TRG5
    see all
  • Pathway

    Fermentation; pyruvate fermentation to lactate; (S)-lactate from pyruvate: step 1/1.
  • Involvement in disease

    Note=Defects in LDHB result in deficiency of lactate dehydrogenase, a condition with no clear symptomatic consequences. Lactate dehydrogenase deficiency can probably be considered a non-disease.
  • Sequence similarities

    Belongs to the LDH/MDH superfamily. LDH family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab223027.

References

ab223027 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223027.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up