Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELAL VDVMEDKLKGEMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQ QEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNPVDILTYVAWKI SGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVLGEHGDSSVPV WSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSW AIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGI SDVVKVTLTPEEEARLKKSADTLWGIQKELQFLEHHHHHH
    • Molecular weight

      38 kDa including tags
    • Amino acids

      1 to 332
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 1 to 332.

Specifications

Our Abpromise guarantee covers the use of ab222451 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity is > 250 units/mg, and is defined as the amount of enzyme that converts 1.0 µmole of pyruvate to L-lactate per minute at pH 7.5 at 37C.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Cell proliferation-inducing gene 19 protein
    • GSD11
    • L lactate dehydrogenase B chain
    • L-lactate dehydrogenase A chain
    • Lactate dehydrogenase A
    • Lactate dehydrogenase B
    • Lactate dehydrogenase c variant 1
    • Lactate dehydrogenase c variant 3
    • Lactate dehydrogenase c variant 4
    • Lactate dehydrogenase C4
    • Lactate dehydrogenase H chain
    • Lactate dehydrogenase M
    • LDH A
    • LDH B
    • LDH H
    • LDH heart subunit
    • LDH M
    • LDH muscle subunit
    • LDH-A
    • LDH-M
    • LDH1
    • ldha
    • LDHA_HUMAN
    • LDHBD
    • LDHM
    • MS1111
    • PIG19
    • Proliferation inducing gene 19
    • Proliferation-inducing gene 19
    • Renal carcinoma antigen NY REN 46
    • Renal carcinoma antigen NY-REN-59
    • TRG 5
    • TRG5
    see all
  • Pathway

    Fermentation; pyruvate fermentation to lactate; (S)-lactate from pyruvate: step 1/1.
  • Involvement in disease

    Defects in LDHA are the cause of glycogen storage disease type 11 (GSD11) [MIM:612933]. A metabolic disorder that results in exertional myoglobinuria, pain, cramps and easy fatigue.
  • Sequence similarities

    Belongs to the LDH/MDH superfamily. LDH family.
  • Post-translational
    modifications

    ISGylated.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 3 μg ab222451 analyzed by 15% SDS-PAGE.

References

ab222451 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222451.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up