Description

  • Product name

    Recombinant Mouse LAG-3 protein (His tag)
    See all LAG-3 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      SGPGKELPVVWAQEGAPVHLPCSLKSPNLDPNFLRRGGVIWQHQPDSGQP TPIPALDLHQGMPSPRQPAPGRYTVLSVAPGGLRSGRQPLHPHVQLEERG LQRGDFSLWLRPALRTDAGEYHATVRLPNRALSCSLRLRVGQASMIASPS GVLKLSDWVLLNCSFSRPDRPVSVHWFQGQNRVPVYNSPRHFLAETFLLL PQVSPLDSGTWGCVLTYRDGFNVSITYNLKVLGLEPVAPLTVYAAEGSRV ELPCHLPPGVGTPSLLIAKWTPPGGGPELPVAGKSGNFTLHLEAVGLAQA GTYTCSIHLQGQQLNATVTLAVITVTPKSFGLPGSRGKLLCEVTPASGKE RFVWRPLNNLSRSCPGPVLEIQEARLLAERWQCQLYEGQRLLGATVYAAE SSSGAHSARRISGDLKGGHLHHHHHH
    • Predicted molecular weight

      46 kDa including tags
    • Amino acids

      23 to 442
    • Tags

      His tag C-Terminus
    • Additional sequence information

      corresponding to extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab215585 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    This product was previously labelled as Lymphocyte Activation Gene 3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C.

    pH: 7.40
    Constituent: PBS

    Lyophilized from a 0.2 µm filtered solution

  • Reconstitution
    Reconstitute with ddH2O to a concentration no less than 100 µg/mL. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • CD223
    • CD223 antigen
    • FDC protein
    • LAG-3
    • Lag3
    • LAG3_HUMAN
    • Lymphocyte activating 3
    • Lymphocyte activation gene 3
    • Lymphocyte activation gene 3 protein
    • Protein FDC
    see all
  • Function

    Involved in lymphocyte activation. Binds to HLA class-II antigens.
  • Tissue specificity

    On cell surface of activated NK and T-lymphocytes.
  • Sequence similarities

    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab215585 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215585.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up