Bioactive grade

Recombinant mouse Leptin Precursor protein (ab222365)

Description

  • Product name

    Recombinant mouse Leptin Precursor protein
  • Biological activity

    The activity is measured in a cell proliferation assay using BaF3 cells and is typically 0.2-1 ng/ml. This corresponds to an expected specific activity of 5 x 106 units/mg.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 0.050 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPIL SLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLP QTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
    • Predicted molecular weight

      16 kDa
    • Amino acids

      22 to 167
    • Additional sequence information

      This product is the mature full length protein from aa 22 to 167. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab222365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituents: 0.1% Trifluoroacetic acid, Mannitol

    Lyophilized from a sterile filtered solution.
    Protein: mannitol, 2:1.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial before opening. Suspend the product by gently pipetting sterile 20 mM HCl down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaw.

Images

  •  SDS PAGE analysis of ab222365 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.

  • Functional Study of ab222365.

References

ab222365 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222365.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up