Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGE PFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRD QKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDH SDKEAFQRKKLGCQLLGTYKQVISVVVQAF
    • Molecular weight
      21 kDa including tags
    • Amino acids
      24 to 203
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is the mature full length protein from aa 24 to 203. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab221320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 92 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CDF
    • Cholinergic Differentiation Factor
    • D factor
    • DIA
    • Differentiation inducing factor
    • differentiation inhibitory activity
    • Differentiation stimulating factor
    • Differentiation-stimulating factor
    • Emfilermin
    • Hepatocyte stimulating factor III
    • HILDA
    • Human interleukin in DA cells
    • Leukemia inhibitory factor
    • LIF
    • LIF_HUMAN
    • Melanoma derived LPL inhibitor
    • Melanoma-derived LPL inhibitor
    • MLPLI
    see all
  • Function
    LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
  • Sequence similarities
    Belongs to the LIF/OSM family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab221320 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 33-45 kDa in SDS-PAGE due to glycosylation.

References

ab221320 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up