Description

  • Product name

    Recombinant Mouse Liver Arginase protein (His tag)
    See all Liver Arginase proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDH GDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGD HSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLK ELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSM TEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLG GLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALT LACFGTQREGNHKPGTDYLKPPK
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      1 to 323
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab226884 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • A I
    • Al
    • ARG 1
    • arg1
    • ARGI1_HUMAN
    • Arginase 1
    • Arginase liver
    • Arginase type I
    • Arginase, liver
    • Arginase-1
    • Arginase1
    • Liver type arginase
    • Liver-type arginase
    • Type I arginase
    see all
  • Pathway

    Nitrogen metabolism; urea cycle; L-ornithine and urea from L-arginine: step 1/1.
  • Involvement in disease

    Defects in ARG1 are the cause of argininemia (ARGIN) [MIM:207800]; also known as hyperargininemia. Argininemia is a rare autosomal recessive disorder of the urea cycle. Arginine is elevated in the blood and cerebrospinal fluid, and periodic hyperammonemia occurs. Clinical manifestations include developmental delay, seizures, mental retardation, hypotonia, ataxia, progressive spastic quadriplegia.
  • Sequence similarities

    Belongs to the arginase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226884 with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab226884 could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Liver Arginase.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab226884 could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Liver Arginase.

References

ab226884 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226884.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up