Description

  • Product name

    Recombinant Mouse LTA protein (His tag)
    See all LTA proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRA FLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQ LFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTD GISHLHFSPSSVFFGAFAL
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      34 to 202
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 34 to 202. The signal peptide is not included. N-terminal 10xHis-tag and C-terminal Myc-tag.

Specifications

Our Abpromise guarantee covers the use of ab235554 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as TNF beta

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • LTalpha
    • DAMA-25N12.13-004
    • DIF
    • LT
    • LT alpha
    • LT-alpha
    • Lta
    • Lymphotoxin alpha
    • Lymphotoxin alpha (TNF superfamily, member 1)
    • Lymphotoxin-alpha
    • MGC117668
    • OTTHUMP00000037612
    • OTTHUMP00000037613
    • TNF B
    • TNF superfamily member 1
    • TNF, lymphocyte-derived
    • TNF-beta
    • TNFB
    • TNFB_HUMAN
    • TNFbeta
    • TNFSF 1
    • TNFSF1
    • TNLG1E
    • Tumor necrosis factor beta
    • tumor necrosis factor ligand 1E
    • Tumor necrosis factor ligand superfamily member 1
    • tumor necrosis factor superfamily member 1
    see all
  • Function

    Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.
  • Involvement in disease

    Genetic variations in LTA are a cause of susceptibility psoriatic arthritis (PSORAS) [MIM:607507]. PSORAS is an inflammatory, seronegative arthritis associated with psoriasis. It is a heterogeneous disorder ranging from a mild, non-destructive disease to a severe, progressive, erosive arthropathy. Five types of psoriatic arthritis have been defined: asymmetrical oligoarthritis characterized by primary involvement of the small joints of the fingers or toes; asymmetrical arthritis which involves the joints of the extremities; symmetrical polyarthritis characterized by a rheumatoidlike pattern that can involve hands, wrists, ankles, and feet; arthritis mutilans, which is a rare but deforming and destructive condition; arthritis of the sacroiliac joints and spine (psoriatic spondylitis).
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Secreted. Membrane. The homotrimer is secreted. The heterotrimer is membrane-associated.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235554.

References

ab235554 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235554.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up