Recombinant Mouse LTA protein (Tagged) (ab269056)
Key features and details
- Expression system: Baculovirus infected Sf9 cells
- Purity: > 90% SDS-PAGE
- Endotoxin level: < 0.100 Eu/µg
- Tags: GST tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Mouse LTA protein (Tagged)
See all TNF beta proteins and peptides -
Purity
> 90 % SDS-PAGE.
Affinity purified. -
Endotoxin level
< 0.100 Eu/µg -
Expression system
Baculovirus infected Sf9 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRA FLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQ LFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTD GISHLHFSPSSVFFGAFAL -
Molecular weight information
43 kDa by SDS-PAGE -
Amino acids
34 to 202 -
Tags
GST tag N-Terminus
-
-
Description
Recombinant Mouse TNF beta protein (Tagged)
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab269056 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.50
Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- LTalpha
- DAMA-25N12.13-004
- DIF
see all -
Function
Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo. -
Involvement in disease
Genetic variations in LTA are a cause of susceptibility psoriatic arthritis (PSORAS) [MIM:607507]. PSORAS is an inflammatory, seronegative arthritis associated with psoriasis. It is a heterogeneous disorder ranging from a mild, non-destructive disease to a severe, progressive, erosive arthropathy. Five types of psoriatic arthritis have been defined: asymmetrical oligoarthritis characterized by primary involvement of the small joints of the fingers or toes; asymmetrical arthritis which involves the joints of the extremities; symmetrical polyarthritis characterized by a rheumatoidlike pattern that can involve hands, wrists, ankles, and feet; arthritis mutilans, which is a rare but deforming and destructive condition; arthritis of the sacroiliac joints and spine (psoriatic spondylitis). -
Sequence similarities
Belongs to the tumor necrosis factor family. -
Cellular localization
Secreted. Membrane. The homotrimer is secreted. The heterotrimer is membrane-associated. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab269056 has not yet been referenced specifically in any publications.