Description

  • Product name

    Recombinant Mouse LTBR protein
    See all LTBR proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      SQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQD TVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQ PGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHF QNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEPVDDIEGRMD EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      28 to 218
    • Additional sequence information

      FC tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab185858 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • CD18
    • D12S370
    • LT beta R
    • LTBETAR
    • Ltbr
    • Lymphotoxin B receptor
    • Lymphotoxin beta receptor
    • Lymphotoxin beta receptor (TNFR superfamily, member 3)
    • Lymphotoxin-beta receptor
    • TNF R III
    • TNF-RIII
    • TNFCR
    • TNFR RP
    • TNFR superfamily member 3
    • TNFR-III
    • TNFR2 RP
    • TNFR2RP
    • TNFR3
    • TNFRII
    • TNFRRP
    • TNFRSF 3
    • TNFRSF3
    • TNR3_HUMAN
    • Tumor necrosis factor C receptor
    • Tumor necrosis factor receptor 2 related protein
    • Tumor necrosis factor receptor 2-related protein
    • Tumor necrosis factor receptor superfamily member 3
    • Tumor necrosis factor receptor superfamily member 3 precursor
    • Tumor necrosis factor receptor type III
    see all
  • Function

    Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab185858 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185858.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up