Description

  • Product name

    Recombinant Mouse LTBR protein (Fc Chimera)
    See all LTBR proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 0.001 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      KPQAPELRGSSQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEF VFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCT SDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDV NCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPE PGAMPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Predicted molecular weight

      49 kDa
    • Amino acids

      28 to 221
    • Additional sequence information

      Recombinant fragment of mouse LTBR (amino acids 21-221) fused at C terminal with Fc portion of human IgG1 (amino acids 100-330).

Specifications

Our Abpromise guarantee covers the use of ab198752 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.8% Sodium chloride, 0.02% Potassium chloride, 99% Phosphate Buffer

General Info

  • Alternative names

    • CD18
    • D12S370
    • LT beta R
    • LTBETAR
    • Ltbr
    • Lymphotoxin B receptor
    • Lymphotoxin beta receptor
    • Lymphotoxin beta receptor (TNFR superfamily, member 3)
    • Lymphotoxin-beta receptor
    • TNF R III
    • TNF-RIII
    • TNFCR
    • TNFR RP
    • TNFR superfamily member 3
    • TNFR-III
    • TNFR2 RP
    • TNFR2RP
    • TNFR3
    • TNFRII
    • TNFRRP
    • TNFRSF 3
    • TNFRSF3
    • TNR3_HUMAN
    • Tumor necrosis factor C receptor
    • Tumor necrosis factor receptor 2 related protein
    • Tumor necrosis factor receptor 2-related protein
    • Tumor necrosis factor receptor superfamily member 3
    • Tumor necrosis factor receptor superfamily member 3 precursor
    • Tumor necrosis factor receptor type III
    see all
  • Function

    Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of ab198752 (2 μg) with Coomassie staining.

    Note: This protein runs at a higher apparent M.W. by SDS-PAGE due to glycosylation.

References

This product has been referenced in:

  • Xiao X  et al. Lymphotoxin ß receptor-mediated NF?B signaling promotes glial lineage differentiation and inhibits neuronal lineage differentiation in mouse brain neural stem/progenitor cells. J Neuroinflammation 15:49 (2018). Read more (PubMed: 29463313) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198752.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up