Description

  • Product name

    Recombinant Mouse Ly6c protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLS FCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      27 to 109
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 27 to 109. The signal peptide and propeptide are not included. N-terminal 6xHis-SUMOSTAR-tag.

Specifications

Our Abpromise guarantee covers the use of ab240852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Ly 6c
    • Ly6c protein
    • Ly6c1
    • Ly6c2
    • Lymphocyte antigen 6 complex
    • Lymphocyte antigen 6 complex locus C
    • Lymphocyte antigen 6C
    • Lymphocyte antigen 6C1
    • Lymphocyte antigen 6C2
    • Lymphocyte antigen Ly 6C
    see all
  • Relevance

    Ly6C is a monocyte/macrophage and endothelial cell differentiation antigen regulated by interferon gamma, and may play a role in the development and maturation of lymphocytes. It is a member of the Ly6 multigene family of type V glycophosphatidylinositol anchored cell surface proteins. It is expressed on bone marrow cells, monocytes/macrophages, neutrophils, endothelial cells, and T cell subsets. Mice with the Ly6.2 allotype (e.g., AKR, C57BL, C57BR, C57L, DBA/2, PL, SJL, SWR, 129) have subsets of CD4+Ly6C+ and CD8+Ly6C+ cells, while Ly6.1 strains (e.g., A, BALB/c, CBA, C3H/He, DBA/1, NZB) have only CD8+Ly6C+ lymphocytes.
  • Cellular localization

    Cell membrane; Lipid-anchor, GPI-anchor.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab240852.

References

ab240852 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab240852.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up