Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQV ESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKF KAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDS TTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFK NEAAG
    • Molecular weight

      35 kDa
    • Amino acids

      24 to 228
    • Additional sequence information

      Recombinant fragment fused to the N-terminus of the Fc region of mouse IgG2a.

Specifications

Our Abpromise guarantee covers the use of ab214558 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 5.000 Eu/mg
  • Purity

    >= 98 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Reconstitution
    Reconstitute with 50 µL sterile water. Add 1X PBS to the desired protein concentration. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • Cell surface retention sequence-binding protein 1
    • CRSBP 1
    • CRSBP-1
    • CRSBP1
    • extracellular link domain containing 1
    • extracellular link domain-containing 1
    • Extracellular link domain-containing protein 1
    • HAR
    • Hyaluronic acid receptor
    • Lymphatic endothelium specific hyaluronan receptor
    • lymphatic vessel endothelial hyaluronan receptor 1
    • Lymphatic vessel endothelial hyaluronic acid receptor 1
    • LYVE 1
    • LYVE-1
    • LYVE1
    • LYVE1_HUMAN
    • XLKD1
    see all
  • Function

    Ligand-specific transporter trafficking between intracellular organelles (TGN) and the plasma membrane. Plays a role in autocrine regulation of cell growth mediated by growth regulators containing cell surface retention sequence binding (CRS). May act as a hyaluronan (HA) transporter, either mediating its uptake for catabolism within lymphatic endothelial cells themselves, or its transport into the lumen of afferent lymphatic vessels for subsequent re-uptake and degradation in lymph nodes.
  • Tissue specificity

    Mainly expressed in endothelial cells lining lymphatic vessels.
  • Sequence similarities

    Contains 1 Link domain.
  • Post-translational
    modifications

    O-glycosylated.
  • Cellular localization

    Membrane. Localized to the plasma membrane and in vesicles near extranuclear membranes which may represent trans-Golgi network (TGN) and endosomes/prelysosomeal compartments. Undergoes ligand-dependent internalization and recycling at the cell surface.
  • Information by UniProt

References

ab214558 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214558.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up