Description

  • Product name

    Recombinant Mouse M-CSF protein (His tag)
    See all M-CSF proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYL KKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNK ACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRD VVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGS SLLPSELPLRIEDPGSAKQRPPRSTCQTLEVDHHHHHH
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      33 to 262
    • Tags

      His tag C-Terminus
    • Additional sequence information

      from extracellular domain

Specifications

Our Abpromise guarantee covers the use of ab215579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C.

    pH: 7.40
    Constituent: 100% PBS

  • Reconstitution
    Reconstitute with ddH2O to a concentration no less than 100 µg/mL. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • Colony stimulating factor 1
    • Colony stimulating factor 1 (macrophage)
    • Colony stimulating factor macrophage specific
    • CSF 1
    • CSF-1
    • CSF1
    • CSF1_HUMAN
    • Csfm
    • Lanimostim
    • M CSF
    • M-CSF
    • Macrophage colony stimulating factor
    • Macrophage Colony Stimulating Factor 1
    • MCSF
    • MGC31930
    • Processed macrophage colony-stimulating factor 1
    see all
  • Function

    Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy.
  • Post-translational
    modifications

    Glycosylation and proteolytic cleavage yield different soluble forms. A high molecular weight soluble form is a proteoglycan containing chondroitin sulfate.
    Isoform 1 is N- and O-glycosylated. Isoform 3 is N-glycosylated.
  • Cellular localization

    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

References

ab215579 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215579.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up