Description

  • Product name

    Recombinant Mouse Macrophage Inflammatory Protein 1 gamma
    See all Macrophage Inflammatory Protein 1 gamma proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MQITHATETKEVQSSLKAQQGLEIEMFHMGFQDSSDCCLSYNSRIQCSRF IGYFPTSGGCTRPGIIFISKRGFQVCANPSDRRVQRCIERLEQNSQPRTY KQ
    • Predicted molecular weight

      12 kDa
    • Amino acids

      22 to 122
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab192290 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Reconstitute for long term storage.

    pH: 8.0
    Constituents: 0.32% Tris HCl, 1.74% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.

General Info

  • Alternative names

    • CCF18
    • Ccl9
    • CCL9(31-101)
    • CCL9_MOUSE
    • Chemokine CC motif ligand 9
    • Macrophage inflammatory protein 1-gamma
    • Macrophage inflammatory protein-related protein 2
    • MIP-1-gamma
    • MRP-2
    • SCYA10
    • SCYA9
    • Small inducible cytokine A9
    • Small-inducible cytokine A9
    see all
  • Function

    Monokine with inflammatory, pyrogenic and chemokinetic properties. Circulates at high concentrations in the blood of healthy animals. Binding to a high-affinity receptor activates calcium release in neutrophils. It also inhibits colony formation of bone marrow myeloid immature progenitors.
  • Tissue specificity

    Expressed mainly in the liver, lung, and the thymus, although some expression has been detected in a wide variety of tissues except brain.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab192290 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192290.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up