Description

  • Product name

    Recombinant mouse MAP3K8/COT protein (His tag)
    See all MAP3K8/COT proteins and peptides
  • Biological activity

    Specific Activity: 8.5 pmole/min/mg.

     

    Reaction was performed in a kinase buffer (40 mM Tris, 10 mM MgCl2, 0.1 mg/ml BSA) containing 5 µg inactive MEK1, 20 µM ATP, and ab196418 for 60 minutes at 30°C. The amount of ATP transferred was measured.

  • Purity

    >= 38 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MENLYASEEPGVYEPSLMTMYPDSNQNEERSESLLRSGQEVPWLSSVRYG TVEDLLAFANHVSNMTKHFYGRRPQECGILLNMVISPQNGRYQIDSDVLL VPWKLTYRNIGSGFVPRGAFGKVYLAQDMKTKKRMACKLIPIDQFKPSDV EIQACFRHENIAELYGAVLWGDTVHLFMEAGEGGSVLEKLESCGPMREFE IIWVTKHILKGLDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVKMTE DVYLPKDLRGTEIYMSPEVILCRGHSTKADIYSLGATLIHMQTGTPPWVK RYPRSAYPSYLYIIHKQAPPLEDIAGDCSPGMRELIEAALERNPNHRPKA ADLLKHEALNPPREDQPR
    • Predicted molecular weight

      70 kDa including tags
    • Amino acids

      30 to 397
    • Tags

      His tag N-Terminus , GST tag N-Terminus
    • Additional sequence information

      NM_007746.

Specifications

Our Abpromise guarantee covers the use of ab196418 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as MAP3K8

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 0.91% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.15% Glutathione, 0.05% DTT, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • AURA2
    • c COT
    • Cancer Osaka thyroid oncogene
    • CCOT
    • COT
    • COT proto oncogene serine/threonine protein kinase
    • EST
    • ESTF
    • Ewing sarcoma transformant
    • FLJ10486
    • M3K8_HUMAN
    • MAP3K 8
    • MAP3K8
    • MEKK8
    • Mitogen activated protein kinase kinase kinase 8
    • Mitogen-activated protein kinase kinase kinase 8
    • Proto oncogene cCot
    • Proto-oncogene c-Cot
    • Serine/threonine protein kinase cot
    • Serine/threonine-protein kinase cot
    • TPL 2
    • TPL-2
    • TPL2
    • Tumor progression locus 2
    see all
  • Function

    Required for TLR4 activation of the MEK/ERK pathway. Able to activate NF-kappa-B 1 by stimulating proteasome-mediated proteolysis of NF-kappa-B 1/p105. Plays a role in the cell cycle. The longer form has some transforming activity, although it is much weaker than the activated cot oncoprotein.
  • Tissue specificity

    Expressed in several normal tissues and human tumor-derived cell lines.
  • Sequence similarities

    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Developmental stage

    Isoform 1 is activated specifically during the S and G2/M phases of the cell cycle.
  • Post-translational
    modifications

    Autophosphorylated. Isoform 1 undergoes phosphorylation mainly on Ser residues, and isoform 2 on both Ser and Thr residues.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of 2.5 μg ab196418 with Coomassie staining.

  • Activity assay of ab196418.

References

ab196418 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196418.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up