Description

  • Product name

    Recombinant Mouse MCP2 protein (His tag)
    See all MCP2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      EKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQG MSLCVDPTQKWVSEY MEILDQKSQILQPHHHHHH
    • Predicted molecular weight

      10 kDa including tags
    • Amino acids

      20 to 97
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature protein without signal peptide

Specifications

Our Abpromise guarantee covers the use of ab215615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

  • Reconstitution
    Reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. yophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days.

General Info

  • Alternative names

    • Ccl8
    • CCL8_HUMAN
    • HC14
    • MCP-2
    • MCP-2(6-76)
    • Monocyte chemoattractant protein 2
    • Monocyte chemotactic protein 2
    • SCYA10
    • SCYA8
    • Small-inducible cytokine A8
    see all
  • Function

    Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.
  • Tissue specificity

    Highest expression found in the small intestine and peripheral blood cells. Intermediate levels seen in the heart, placenta, lung, skeletal muscle, thymus, colon, ovary, spinal cord and pancreas. Low levels seen in the brain, liver, spleen and prostate.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    N-terminal processed form MCP-2(6-76) is produced by proteolytic cleavage after secretion from peripheral blood monocytes.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab215615 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215615.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up