Bioactive grade

Recombinant mouse MCSF Receptor protein (Active) (ab219686)

Description

  • Product name

    Recombinant mouse MCSF Receptor protein (Active)
    See all MCSF Receptor proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized Mouse MCSF Protein at 5 μg/ml (100 μl/well) can bind ab219686 with a linear range of 0.078-0.625 μg/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTL TTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVE GQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKV LDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEA AQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVD FQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSL ILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRV KASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDV SGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQ LPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES
    • Predicted molecular weight

      57 kDa including tags
    • Amino acids

      20 to 511
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_001032948.

Specifications

Our Abpromise guarantee covers the use of ab219686 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • C FMS
    • CD 115
    • CD115
    • CD115 antigen
    • CFMS
    • Colony stimulating factor 1 receptor
    • Colony stimulating factor I receptor
    • CSF 1 R
    • CSF 1R
    • CSF-1 receptor
    • CSF-1-R
    • CSF1 R
    • CSF1R
    • CSF1R_HUMAN
    • CSFR
    • EC 2.7.10.1
    • FIM 2
    • FIM2
    • FMS
    • FMS proto oncogene
    • FMS protooncogene
    • HDLS
    • M-CSF Receptor
    • M-CSF-R
    • Macrophage colony stimulating factor 1 receptor
    • Macrophage colony stimulating factor I receptor
    • Macrophage colony-stimulating factor 1 receptor
    • McDonough feline sarcoma viral (v fms) oncogene homolog
    • MCSFR
    • Oncogen FMS
    • Proto-oncogene c-Fms
    • V-FMS McDonough feline sarcoma viral oncogen homolog, formerly
    see all
  • Function

    Protein tyrosine-kinase transmembrane receptor for CSF1 and IL34.
  • Tissue specificity

    Expressed in bone marrow and in differentiated blood mononuclear cells.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab219686 under reducing conditions, stained overnight with Coomassie Blue.

    The protein migrates as 66-100 kDa on a SDS-PAGE gel under reducing conditions due to glycosylation.

  • Immobilized Mouse MCSF Protein at 5 μg/ml (100 μl/well) can bind ab219686 with a linear range of 0.078-0.625 μg/ml.

References

ab219686 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219686.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up