Description

  • Product name

    Recombinant mouse MIF protein (Active)
    See all MIF proteins and peptides
  • Biological activity

    The activity is determined by its ability to activate MAP Kinase signaling (via ERK) and is detectable starting at 10 ng/ml.  This corresponds to an expected specific activity of 1 x 105 units/mg.

  • Purity

    > 95 % SDS-PAGE.
    Purity determined by reducing and non-reducing SDS-PAGE.
  • Endotoxin level

    < 0.050 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTF SGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYY DMNAANVGWNGSTFA
    • Predicted molecular weight

      13 kDa
    • Amino acids

      1 to 115
    • Additional sequence information

      Non-glycosylated.

Specifications

Our Abpromise guarantee covers the use of ab219128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituent: 0.16% Sodium phosphate

    Lyophilised from a sterile filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial before opening. Reconstitute with sterile water at 0.1 mg/ml. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. The product works best when used fresh after reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • GIF
    • GLIF
    • Glycosylation inhibiting factor
    • Glycosylation-inhibiting factor
    • L-dopachrome isomerase
    • L-dopachrome tautomerase
    • Macrophage migration inhibitory factor
    • Macrophage migration inhibitory factor (glycosylation-inhibiting factor)
    • MIF
    • MIF protein
    • MIF_HUMAN
    • MMIF
    • Phenylpyruvate tautomerase
    see all
  • Function

    Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
  • Involvement in disease

    Genetic variations in MIF are associated with susceptibility to rheumatoid arthritis systemic juvenile (RASJ) [MIM:604302]. An inflammatory articular disorder with systemic-onset beginning before the age of 16. It represents a subgroup of juvenile arthritis associated with severe extraarticular features and occasionally fatal complications. During active phases of the disorder, patients display a typical daily spiking fever, an evanescent macular rash, lymphadenopathy, hepatosplenomegaly, serositis, myalgia and arthritis.
  • Sequence similarities

    Belongs to the MIF family.
  • Cellular localization

    Secreted. Cytoplasm. Does not have a cleavable signal sequence and is secreted via a specialized, non-classical pathway. Secreted by macrophages upon stimulation by bacterial lipopolysaccharide (LPS), or by M.tuberculosis antigens.
  • Information by UniProt

Images

  •  SDS PAGE analysis of ab219128 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.

  • pERK induction in RAW 264.7 cells by ab219128.

References

ab219128 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up