Description

  • Product name

    Recombinant Mouse Milk Fat Globule 1 protein (His tag)
    See all Milk Fat Globule 1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab219444 was purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      ADLASGDFCDSSLCLNGGTCLTGQDNDIYCLCPEGFTGLVCNETERGPCS PNPCYNDAKCLVTLDTQRGDIFTEYICQCPVGYSGIHCETGCSTQLGMEG GAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASNYDSKPWI QVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGG DKEFLGNLDNNSLKVNMFNPTLEAQYIKLYPVSCHRGCTLRFELLGCELH GCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAW TAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGV QWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITL RLELLGCHHHHHH
    • Predicted molecular weight

      46 kDa including tags
    • Amino acids

      23 to 426
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This is the mature protein without the signal peptide (NP_001038954). The predicted N terminal is Ala 23.

Specifications

Our Abpromise guarantee covers the use of ab219444 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • BA46
    • Breast epithelial antigen BA46
    • EDIL1
    • HMFG
    • hP47
    • HsT19888
    • Lactadherin
    • Medin
    • MFG-E8
    • MFGE8
    • MFGM
    • MFGM_HUMAN
    • Milk fat globule EGF factor 8
    • Milk fat globule EGF factor 8 protein
    • Milk fat globule-EGF factor 8
    • O acetyl disialoganglioside synthase
    • OAcGD3S
    • SED1
    • SPAG10
    • Sperm associated antigen 10
    • Sperm surface protein hP47
    see all
  • Function

    Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization (By similarity). Contributes to phagocytic removal of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction. Binds specifically to rotavirus and inhibits its replication.
    Medin is the main constituent of aortic medial amyloid.
  • Tissue specificity

    Mammary epithelial cell surfaces and aortic media. Overexpressed in several carcinomas.
  • Sequence similarities

    Contains 1 EGF-like domain.
    Contains 2 F5/8 type C domains.
  • Post-translational
    modifications

    Medin has a ragged N-terminus with minor species starting at Pro-264 and Gly-273.
  • Cellular localization

    Membrane. Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab219444 (3µg).   

References

ab219444 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219444.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up