Recombinant Mouse MRP8 protein (Tagged) (ab235971)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Mouse MRP8 protein (Tagged)
See all MRP8 proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINI ENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE -
Predicted molecular weight
26 kDa including tags -
Amino acids
2 to 89 -
Tags
His tag N-Terminus -
Additional sequence information
N-terminal 6xHis-SUMO-tagged.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab235971 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- 60B8Ag
- AI323541
- B8Ag
see all -
Function
Calcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS) (By similarity). Promotes tubulin polymerization. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as pro-inflammatory mediator in acute and chronic inflammation and up-regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions. -
Tissue specificity
Expressed by macrophages in chronic inflammations. Also expressed in epithelial cells constitutively or induced during dermatoses. -
Sequence similarities
Belongs to the S-100 family.
Contains 2 EF-hand domains. -
Cellular localization
Secreted. Cytoplasm. Cytoplasm > cytoskeleton. Cell membrane. Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood leukocytes upon exposure to CSF2/GM-CSF, bacterial lipopolysaccharide (LPS) and during inflammatory processes. Serum levels are high in patients suffering from chronic inflammation. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab235971 has not yet been referenced specifically in any publications.