Recombinant Mouse MRP8 protein (Tagged) (ab235971)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant Mouse MRP8 protein (Tagged)
See all MRP8 proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINI ENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE -
Predicted molecular weight
26 kDa including tags -
Amino acids
2 to 89 -
Tags
His tag N-Terminus -
Additional sequence information
N-terminal 6xHis-SUMO-tagged.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab235971 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol
General Info
-
Alternative names
- 60B8Ag
- AI323541
- B8Ag
see all -
Function
Calcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS) (By similarity). Promotes tubulin polymerization. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as pro-inflammatory mediator in acute and chronic inflammation and up-regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions. -
Tissue specificity
Expressed by macrophages in chronic inflammations. Also expressed in epithelial cells constitutively or induced during dermatoses. -
Sequence similarities
Belongs to the S-100 family.
Contains 2 EF-hand domains. -
Cellular localization
Secreted. Cytoplasm. Cytoplasm > cytoskeleton. Cell membrane. Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood leukocytes upon exposure to CSF2/GM-CSF, bacterial lipopolysaccharide (LPS) and during inflammatory processes. Serum levels are high in patients suffering from chronic inflammation. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Mouse MRP8 protein (Tagged) (ab235971)(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab235971.
Datasheets and documents
References
ab235971 has not yet been referenced specifically in any publications.
