Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      EKLPKAPVITTPLETVDALVEEVATFMCAVESYPQPEISWTRNKILIKLF DTRYSIRENGQLLTILSVEDSDDGIYCCIANNGVGGAVESCGALQVKMKP KITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDNALRENSRIAVLE SGSLRIHNVQKEDAGQYRCVAKNSLGTAYSKLVKLEVEVFARILRAPESH NVTFGSFVTLRCTAIGIPVPTISWIENGNAVSSGSIQESVKDRVIDSRLQ LFITKPGLYTCIATNKHGEKFSTAKAAATVSIAEWSKSQKDSQGYCAQYR GEVCDAVLAKDALVFFNTSYRDPEDAQELLIHTAWNELKAVSPLCRPAAE ALLCNHLFQECSPGVVPTPMPICREYCLAVKELFCAKEWQAMEGKAHRGL YRSGMHLLPVPECSKLPSMHRDPTACTRLPYLDYKKENITTFPSITS
    • Molecular weight

      69 kDa including tags
    • Amino acids

      22 to 468
    • Tags

      His tag N-Terminus
    • Additional sequence information

      6xHis-SUMO tag at the N-terminus and Myc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab226426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • CMS9
    • FADS
    • MDK 4
    • MDK4
    • MGC126323
    • MGC126324
    • Muscle
    • Muscle associated receptor tyrosine kinase
    • Muscle skeletal receptor tyrosine kinase
    • Muscle skeletal receptor tyrosine protein kinase
    • Muscle specific kinase receptor
    • Muscle specific tyrosine kinase receptor
    • Muscle specific tyrosine protein kinase receptor
    • Muscle-specific kinase receptor
    • Muscle-specific tyrosine-protein kinase receptor
    • MuSK
    • MUSK_HUMAN
    • Neural fold somite kinase 1
    • Neural fold somite kinase 2
    • Neural fold somite kinase 3
    • Neural fold somite kinase1
    • Neural fold somite kinase2
    • Neural fold somite kinase3
    • Nsk 1
    • Nsk 2
    • Nsk 3
    • Nsk1
    • Nsk2
    • Nsk3
    • Receptor tyrosine kinase MuSK
    • Skeletal muscle receptor tyrosine kinase
    • skeletal receptor tyrosine-protein kinase
    see all
  • Function

    Receptor tyrosine kinase that is a key mediator of agrin's action and is involved in neuromuscular junction (NMJ) organization.
  • Involvement in disease

    Defects in MUSK is a cause of congenital myasthenic syndrome with acetylcholine receptor deficiency (CMS-ACHRD) [MIM:608931]. A post-synaptic congenital myasthenic syndrome. Mutations underlying AChR deficiency cause a 'loss of function' and show recessive inheritance. Note=MUSK mutations lead to decreased agrin-dependent AChR aggregation, a critical step in the formation of the neuromuscular junction.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family.
    Contains 1 FZ (frizzled) domain.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Ubiquitinated by PDZRN3. Ubiquitination promotes endocytosis and lysosomal degradation.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226426 with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab226426 could indicate that this peptide derived from E.coli-expressed mouse Musk.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab226426 could indicate that this peptide derived from E.coli-expressed mouse Musk.

References

ab226426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up