Description

  • Product name

    Recombinant mouse NGF protein (Animal Free)
    See all NGF proteins and peptides
  • Biological activity

    The activity as determined by the proliferation of TF-1 cells and is typically less than 1 ng/ml. This corresponds to an expected specific activity of 1 x 106 units/mg.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 0.050 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVF RQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAW RFIRIDTACVCVLSRKATRRG
    • Predicted molecular weight

      14 kDa
    • Amino acids

      122 to 241
    • Additional sequence information

      This product is the mature full length protein from aa 122 to 241. The signal peptide and propeptide are not included. Homodimer.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab222367 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituent: 0.1% Trifluoroacetic acid

    Lyophilized from a sterile filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial before opening. Suspend the product by gently pipetting sterile deionized water down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaw.

General Info

  • Alternative names

    • Beta nerve growth factor
    • Beta NGF
    • Beta-nerve growth factor
    • Beta-NGF
    • HSAN5
    • MGC161426
    • MGC161428
    • Nerve growth factor
    • Nerve growth factor (beta polypeptide)
    • Nerve growth factor beta
    • Nerve growth factor beta polypeptide
    • Nerve growth factor beta subunit
    • NGF
    • NGF_HUMAN
    • NGFB
    • NID67
    see all
  • Function

    Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI (PubMed:20164177).
  • Involvement in disease

    Neuropathy, hereditary sensory and autonomic, 5
  • Sequence similarities

    Belongs to the NGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Functional analysis of ab222367
  •  SDS PAGE analysis of ab222365 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.

References

ab222367 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222367.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up