Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSIEKIWAREILDSRGNPTVEVDLYTA KGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHINSRIAPAL ISSGISVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERD LPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAES FRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELV KEAIDKAGYTEKMVIGMDVAASEFYRDGKYDLDFKSPADPSRYITGDQLG ALYQDFVRNYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKR IERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETE DTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHN FRNPSVL
    • Molecular weight

      50 kDa including tags
    • Amino acids

      1 to 434
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_038537.

Specifications

Our Abpromise guarantee covers the use of ab222947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity is > 10,000 pmol/min/μg, and was obtained by measuring the decrease of NAD in absorbance at 340 nm resulting from NADH at pH 6.5 at 37°C.

  • Applications

    SDS-PAGE

    Functional Studies

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    ab222947 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 2 phospho D glycerate hydrolyase
    • 2-phospho-D-glycerate hydro-lyase
    • Eno 2
    • ENO2
    • ENOG
    • ENOG_HUMAN
    • Enolase 2
    • Enolase 2 (gamma, neuronal)
    • Enolase 2 gamma neuronal
    • Enolase2
    • Epididymis secretory protein Li 279
    • Gamma enolase
    • Gamma-enolase
    • HEL S 279
    • Neural enolase
    • Neuron specific enolase
    • Neuron specific gamma enolase
    • Neuron-specific enolase
    • neuronal enriched enolase
    • Neurone specific enolase
    • NSE
    see all
  • Function

    Has neurotrophic and neuroprotective properties on a broad spectrum of central nervous system (CNS) neurons. Binds, in a calcium-dependent manner, to cultured neocortical neurons and promotes cell survival.
  • Tissue specificity

    The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
  • Pathway

    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 4/5.
  • Sequence similarities

    Belongs to the enolase family.
  • Developmental stage

    During ontogenesis, there is a transition from the alpha/alpha homodimer to the alpha/beta heterodimer in striated muscle cells, and to the alpha/gamma heterodimer in nerve cells.
  • Cellular localization

    Cytoplasm. Cell membrane. Can translocate to the plasma membrane in either the homodimeric (alpha/alpha) or heterodimeric (alpha/gamma) form.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222947.

References

ab222947 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up