Description

  • Product name

    Recombinant Mouse OCM protein (Tagged)
    See all OCM proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFI DNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGAD EFQEMVHS
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      2 to 109
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-SUMO-tagged.

Specifications

Our Abpromise guarantee covers the use of ab235804 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as oncomodulin

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Ocm
    • OCMN
    • OM
    • onco
    • ONCO_HUMAN
    • Oncomodulin-1
    • Parvalbumin beta
    see all
  • Function

    Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.
  • Sequence similarities

    Belongs to the parvalbumin family.
    Contains 2 EF-hand domains.
  • Information by UniProt

Images

  • ab235804 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235804 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235804.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up