Description

  • Product name

    Recombinant Mouse Ogg1 protein (His tag)
    See all Ogg1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab222985 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMLFRSWLPSSMRHRTLSSSPALWASIP CPRSELRLDLVLASGQSFRWKEQSPAHWSGVLADQVWTLTQTEDQLYCTV YRGDDSQVSRPTLEELETLHKYFQLDVSLAQLYSHWASVDSHFQRVAQKF QGVRLLRQDPTECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVT YHGFPNLHALAGPEAETHLRKLGLGYRARYVRASAKAILEEQGGPAWLQQ LRVAPYEEAHKALCTLPGVGAKVADCICLMALDKPQAVPVDVHVWQIAHR DYGWHPKTSQAKGPSPLANKELGNFFRNLWGPYAGWAQAVLFSADLRQPS LSREPPAKRKKGSKRPEG
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      1 to 345
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_035087.

Specifications

Our Abpromise guarantee covers the use of ab222985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 30% Glycerol, PBS

General Info

  • Alternative names

    • 8 hydroxyguanine DNA glycosylase
    • 8 oxoguanine DNA glycosylase
    • 8 oxoguanine DNA glycosylase 1
    • AP lyase
    • DNA (apurinic or apyrimidinic site) lyase
    • DNA apurinic or apyrimidinic site lyase
    • DNA lyase
    • DNA-(apurinic or apyrimidinic site) lyase
    • HMMH
    • HOGG 1
    • HOGG1
    • MMH
    • MUTM
    • N glycosylase
    • Ogg 1
    • Ogg1
    • OGG1_HUMAN
    • OGH 1
    • OGH1
    see all
  • Function

    DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion.
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Defects in OGG1 may be a cause of renal cell carcinoma (RCC) [MIM:144700]. It is a heterogeneous group of sporadic or hereditary carcinoma derived from cells of the proximal renal tubular epithelium. It is subclassified into clear cell renal carcinoma (non-papillary carcinoma), papillary renal cell carcinoma, chromophobe renal cell carcinoma, collecting duct carcinoma with medullary carcinoma of the kidney, and unclassified renal cell carcinoma.
  • Sequence similarities

    Belongs to the type-1 OGG1 family.
  • Cellular localization

    Mitochondrion; Nucleus and Nucleus > nucleoplasm. Nucleus speckle. Nucleus matrix. Together with APEX1 is recruited to nuclear speckles in UVA-irradiated cells.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222985.

References

ab222985 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222985.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up