Description

  • Product name

    Recombinant Mouse Osteopontin protein (His tag)
    See all Osteopontin proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      LPVKVTDSGSSEEKLYSLHPDPIATWLVPDPSQKQNLLAPQNAVSSEEKD DFKQETLPSNSNESHDHMDDDDDDDDDDGDHAESEDSVDSDESDESHHSD ESDETVTASTQADTFTPIVPTVDVPNGRGDSLAYGLRSKSRSFQVSDEQY PDATDEDLTSHMKSGESKESLDVIPVAQLLSMPSDQDNNGKGSHESSQLD EPSLETHRLEHSKESQESADQSDVIDSQASSKASLEHQSHKFHSHKDKLV LDPKSKEDDRYLKFRISHELESSS
    • Predicted molecular weight

      32 kDa including tags
    • Amino acids

      17 to 290
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab241241 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • BNSP
    • Bone sialoprotein 1
    • Bone sialoprotein I
    • BSP I
    • BSPI
    • Early T lymphocyte activation 1
    • ETA 1
    • ETA1
    • MGC110940
    • Nephropontin
    • OPN
    • Osteopontin
    • osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein
    • OSTP_HUMAN
    • PSEC0156
    • Secreted phosphoprotein 1
    • secreted phosphoprotein 1 (osteopontin bone sialoprotein I early T lymphocyte activation 1)
    • secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1)
    • SPP 1
    • SPP-1
    • SPP1
    • SPP1/CALPHA1 fusion
    • Urinary stone protein
    • Uropontin
    see all
  • Function

    Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction.
    Acts as a cytokine involved in enhancing production of interferon-gamma and interleukin-12 and reducing production of interleukin-10 and is essential in the pathway that leads to type I immunity.
  • Tissue specificity

    Bone. Found in plasma.
  • Sequence similarities

    Belongs to the osteopontin family.
  • Post-translational
    modifications

    Extensively phosphorylated on clustered serine residues.
    N- and O-glycosylated.
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab241241.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab241241 could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Osteopontin.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab241241 could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Osteopontin.

References

ab241241 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab241241.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up