Recombinant Mouse Osteoprotegerin protein (His tag) (ab222441)

Description

  • Product name

    Recombinant Mouse Osteoprotegerin protein (His tag)
    See all Osteoprotegerin proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab222441 was purified by conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      ETLPPKYLHYDPETGHQLLCDKCAPGTYLKQHCTVRRKTLCVPCPDHSYT DSWHTSDECVYCSPVCKELQSVKQECNRTHNRVCECEEGRYLEIEFCLKH RSCPPGSGVVQAGTPERNTVCKKCPDGFFSGETSSKAPCIKHTNCSTFGL LLIQKGNATHDNVCSGNREATQKCGIDVTLCEEAFFRFAVPTKIIPNWLS VLVDSLPGTKVNAESVERIKRRHSSQEQTFQLLKLWKHQNRDQEMVKKII QDIDLCESSVQRHLGHSNLTTEQLLALMESLPGKKISPEEIERTRKTCKS SEQLLKLLSLWRIKNGDQDTLKGLMYALKHLKTSHFPKTVTHSLRKTMRF LHSFTMYRLYQKLFLEMIGNQVQSVKISCLLEHHHHHH
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      22 to 401
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab222441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • MGC29565
    • OCIF
    • OPG
    • Osteoclastogenesis inhibitory factor
    • Osteoprotegerin
    • PDB5
    • TNF receptor superfamily member 11b
    • TNFRSF 11B
    • TNFRSF11B
    • TR 1
    • TR1
    • TR11B_HUMAN
    • Tumor necrosis factor receptor superfamily member 11B
    see all
  • Function

    Acts as decoy receptor for RANKL and thereby neutralizes its function in osteoclastogenesis. Inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local RANKL/OPG ratio. May also play a role in preventing arterial calcification. May act as decoy receptor for TRAIL and protect against apoptosis. TRAIL binding blocks the inhibition of osteoclastogenesis.
  • Tissue specificity

    Highly expressed in adult lung, heart, kidney, liver, spleen, thymus, prostate, ovary, small intestine, thyroid, lymph node, trachea, adrenal gland, testis, and bone marrow. Detected at very low levels in brain, placenta and skeletal muscle. Highly expressed in fetal kidney, liver and lung.
  • Involvement in disease

    Defects in TNFRSF11B are the cause of juvenile Paget disease (JPD) [MIM:239000]; also known as hyperostosis corticalis deformans juvenilis or hereditary hyperphosphatasia or chronic congenital idiopathic hyperphosphatasia. JPD is a rare autosomal recessive osteopathy that presents in infancy or early childhood. The disorder is characterized by rapidly remodeling woven bone, osteopenia, debilitating fractures, and deformities due to a markedly accelerated rate of bone remodeling throughout the skeleton. Approximately 40 cases of JPD have been reported worldwide. Unless it is treated with drugs that block osteoclast-mediated skeletal resorption, the disease can be fatal.
  • Sequence similarities

    Contains 2 death domains.
    Contains 4 TNFR-Cys repeats.
  • Post-translational
    modifications

    N-glycosylated. Contains sialic acid residues.
    The N-terminus is blocked.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab222441 (3 μg) was analysed by 15% SDS-PAGE.

    Predicted molecular mass: 44.4 kDa.

References

ab222441 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222441.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up