Recombinant mouse OX40L/TNFSF4 protein (ab168092)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 90% SDS-PAGE
- Endotoxin level: < 0.100 Eu/µg
- Active: Yes
- Tags: DDDDK tag N-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant mouse OX40L/TNFSF4 protein
See all OX40L/TNFSF4 proteins and peptides -
Biological activity
ab168092 binds to Human and mouse CD134 (OX40). It activates T cell proliferation. -
Purity
> 90 % SDS-PAGE. -
Endotoxin level
< 0.100 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
SSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGL YIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDK VYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL -
Predicted molecular weight
28 kDa including tags -
Amino acids
52 to 198 -
Tags
DDDDK tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab168092 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20ºC.
Constituent: 99% PBS
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 100µl sterile water for a final concentration of 0.1mg/ml. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
General Info
-
Alternative names
- CD 134L
- CD 252
- CD134 ligand
see all -
Function
Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. -
Involvement in disease
Genetic variations in TNFSF4 influence susceptibility to systemic lupus erythematosus (SLE) [MIM:152700]. SLE is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Note=The upstream region of TNFSF4 contains a single risk haplotype for SLE, which is correlated with increased expression of both cell-surface TNFSF4 and TNFSF4 transcripts. Increased levels of TNFSF4 are thought to augment T cell-APC interaction and the functional consequences of T cell activation, thereby destabilizing peripheral tolerance. -
Sequence similarities
Belongs to the tumor necrosis factor family. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab168092 has not yet been referenced specifically in any publications.