Description

  • Product name

    Recombinant mouse PAI1 protein
    See all PAI1 proteins and peptides
  • Biological activity

    ab93068 is 80 (+/-) 5% active by uPA titration. The active fraction typically contains 70 percent active PAI1. Active concentration = ~2.0 mg/mL.
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      LPLRESHTAHQATDFGVKVFQQVVQASKDRNVVFSPYGVSSVLAMLQMTT AGKTRRQIQDAMGFKVNEKGTAHALRQLSKELMGPWNKNEISTADAIFVQ RDLELVQGFMPHFFKLFQTMVKQVDFSEVERARFIINDWVERHTKGMIND LLAKGAVDELTRLVLVNALYFSGQWKTPFLEASTHQRLFHKSDGSTVSVP MMAQSNKFNYTEFTTPDGLEYDVVELPYQGDTLSMFIAAPFEKDVHLSAL TNILDAELIRQWKGNMTRLPRLLILPKFSLETEVDLRGPLEKLGMPDMFS ATLADFTSLSDQEQLSVAQALQKVRIEVNESGTVASSSTAFVISARMAPT EMVIDRSFLFVVRHNPTETILFMGQVMEP
    • Amino acids

      24 to 402

Specifications

Our Abpromise guarantee covers the use of ab93068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 5.00
    Constituents: 0.41% Sodium acetate, 0.0292% EDTA, 0.58% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Clade E
    • Endothelial plasminogen activator inhibitor
    • Nexin
    • Nexin plasminogen activator inhibitor type 1
    • PAI
    • PAI 1
    • PAI-1
    • PAI1_HUMAN
    • PLANH1
    • Plasminogen activator inhibitor 1
    • Plasminogen activator inhibitor type 1
    • Serine (or cysteine) proteinase inhibitor
    • Serine (or cysteine) proteinase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1
    • Serine proteinase inhibitor clade E member 1
    • serpin
    • Serpin E1
    • Serpin peptidase inhibitor clade E
    • Serpin peptidase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1
    • Serpine 1
    • SERPINE1
    see all
  • Function

    This inhibitor acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.
  • Tissue specificity

    Found in plasma and platelets and in endothelial, hepatoma and fibrosarcoma cells.
  • Involvement in disease

    Defects in SERPINE1 are the cause of plasminogen activator inhibitor-1 deficiency (PAI-1D) [MIM:613329]. It is a hematologic disorder characterized by increased bleeding after trauma, injury, or surgery. Affected females have menorrhagia. The bleeding defect is due to increased fibrinolysis of fibrin blood clots due to deficiency of plasminogen activator inhibitor-1, which inhibits tissue and urinary activators of plasminogen.
    Note=High concentrations of SERPINE1 seem to contribute to the development of venous but not arterial occlusions.
  • Sequence similarities

    Belongs to the serpin family.
  • Post-translational
    modifications

    Inactivated by proteolytic attack of the urokinase-type (u-PA) and the tissue-type (TPA), cleaving the 369-Arg-
    -Met-370 bond.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 10% SDS-PAGE
    Lane 1: PAI1 (5 µg) Reduced
    Lane 2: PAI1 (5 µg) +uPA-HTC (8 µg) Reduced
    Lane 3: Prestained Standard

References

ab93068 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

It is hard to give an exact answer since there are countless possible experiments where PAI-1 is injected into mice. All of the papers below inject PAI into either rats or mice. Some of the experiments were acute 1 time injections and some were long-term multiple injections. I suggest the end user look at these and depending on what the exact experiment is they should be able to figure out dose, timing etc. Huang Y, Border WA, Lawrence DA, Noble NA. Am J Physiol Renal Physiol. 2009 Oct;297(4):F1045-54. Epub 2009 Jul 22. Mechanisms underlying the antifibrotic properties of noninhibitory PAI-1 (PAI-1R) in experimental nephritis. Wu J, Peng L, McMahon GA, Lawrence DA, Fay WP. Arterioscler Thromb Vasc Biol. 2009 Oct;29(10):1565-70. Epub 2009 Jul 2. Recombinant plasminogen activator inhibitor-1 inhibits intimal hyperplasia. Huang Y, Border WA, Yu L, Zhang J, Lawrence DA, Noble NA. J Am Soc Nephrol. 2008 Feb;19(2):329-38. Epub 2008 Jan 23. A PAI-1 mutant, PAI-1R, slows progression of diabetic nephropathy. Cao C, Lawrence DA, Li Y, Von Arnim CA, Herz J, Su EJ, Makarova A, Hyman BT, Strickland DK, Zhang L. EMBO J. 2006 May 3;25(9):1860-70. Epub 2006 Apr 6. Endocytic receptor LRP together with tPA and PAI-1 coordinates Mac-1-dependent macrophage migration. Stefansson S, Yepes M, Gorlatova N, Day DE, Moore EG, Zabaleta A, McMahon GA, Lawrence DA. J Biol Chem. 2004 Jul 16;279(29):29981-7. Epub 2004 May 6. Mutants of plasminogen activator inhibitor-1 designed to inhibit neutrophil elastase and cathepsin G are more effective in vivo than their endogenous inhibitors. Huang Y, Haraguchi M, Lawrence DA, Border WA, Yu L, Noble NA. J Clin Invest. 2003 Aug;112(3):379-88. A mutant, noninhibitory plasminogen activator inhibitor type 1 decreases matrix accumulation in experimental glomerulonephritis. McMahon GA, Petitclerc E, Stefansson S, Smith E, Wong MK, Westrick RJ, Ginsburg D, Brooks PC, Lawrence DA. J Biol Chem. 2001 Sep 7;276(36):33964-8. Epub 2001 Jul 5. Plasminogen activator inhibitor-1 regulates tumor growth and angiogenesis.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up