Description

  • Product name

    Recombinant Mouse Pancreatic Lipase/PTL protein (His tag)
    See all Pancreatic Lipase/PTL proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      REVCFDKLGCFSDDAPWSGTLDRPLKALPWSPAQINTRFLLYTNENPDNY QLITSDASNIRNSNFRTNRKTRIIIHGFIDKGEENWLSDMCKNMFRVESV NCICVDWKGGSRTTYTQATQNVRVVGAEVALLVNVLQSDLGYSLNNVHLI GHSLGSHIAGEAGKRTFGAIGRITGLDPAEPYFQGTPEEVRLDPTDAQFV DAIHTDAGPIIPNLGFGMSQTVGHLDFFPNGGIEMPGCQKNILSQIVDID GIWEGTRNFAACNHLRSYKFYTDSIVNPTGFAGFSCSSYSLFTANKCFPC GSGGCPQMGHYADRYPGKTSRLYQTFYLNTGDKSNFARWRYQVTVTLSGQ KVTGHILVSLFGNGGNSKQYEVFKGSLQPGTSHVNEFDSDVDVGDLQKVK FIWYNNVINPTLPKVGASRITVERNDGRVFNFCSQETVREDVLLTLSPC
    • Predicted molecular weight

      66 kDa including tags
    • Amino acids

      17 to 465
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 17 to 465 with 6xHis-SUMO tag at the N-terminus. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab226285 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Pancreatic Lipase. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • lipase, pancreatic
    • LIPP_HUMAN
    • Pancreatic lipase
    • Pancreatic triacylglycerol lipase
    • PL
    • PNLIP
    • PNLIPD
    • PTL
    • Triacylglycerol acylhydrolase
    see all
  • Sequence similarities

    Belongs to the AB hydrolase superfamily. Lipase family.
    Contains 1 PLAT domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226285 with 5% enrichment gel and 15% separation gel.

References

ab226285 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226285.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up