For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-mouse-pcsk9-protein-ab167759.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Metabolism Amino Acids
Share by email
Bioactive grade

Recombinant mouse PCSK9 protein (ab167759)

  • Datasheet
Submit a review Submit a question References (2)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

ELISA - Recombinant mouse PCSK9 protein (ab167759)
  • Functional Studies - Recombinant mouse PCSK9 protein (ab167759)
  • SDS-PAGE - Recombinant mouse PCSK9 protein (ab167759)
  • Functional Studies - Recombinant mouse PCSK9 protein (ab167759)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 97% SDS-PAGE
  • Endotoxin level: < 1.000 Eu/µg
  • Active: Yes
  • Tags: His tag C-Terminus
  • Suitable for: Functional Studies, SDS-PAGE, ELISA

You may also be interested in

Primary
Product image
Anti-Chondroitin Sulfate antibody [CS-56] (ab11570)
ELISA
Product image
Mouse PCSK9 ELISA Kit (ab215538)
Pair
Product image
Mouse PCSK9 Matched Antibody Pair Kit (ab218798)

View more associated products

Description

  • Product name

    Recombinant mouse PCSK9 protein
    See all PCSK9 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized Human LDL receptor protein (ab220582) at 10 μg/mL (100 μL/well) can bind ab167759 with a linear range of 0.125-1 μg/mL.

    Measured by its binding ability in a BLI assay. Loaded Recombinant human LDL Receptor protein (ab220570) on Protein A Biosensor, can bind Recombinant mouse PCSK9 protein (ab167759) with an affinity constant of 2.28 nM as determined in BLI assay.

  • Purity

    > 97 % SDS-PAGE.
    ab167759 is lyophilized from 0.22 µm filtered solution. Purified by Immobilized metal affinity chromatography.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

    Q80W65
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      QDEDGDYEELMLALPSQEDGLADEAAHVATATFRRCSKEAWRLPGTYIVV LMEETQRLQIEQTAHRLQTRAARRGYVIKVLHIFYDLFPGFLVKMSSDLL GLALKLPHVEYIEEDSFVFAQSIPWNLERIIPAWHQTEEDRSPDGSSQVE VYLLDTSIQGAHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHLA GVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSG PLVVLLPLAGGYSRILNAACRHLARTGVVLVAAAGNFRDDACLYSPASAP EVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCFMS QSGTSQAAAHVAGIVARMLSREPTLTLAELRQRLIHFSTKDVINMAWFPE DQQVLTPNLVATLPPSTHETGGQLLCRTVWSAHSGPTRTATATARCAPEE ELLSCSSFSRSGRRRGDWIEAIGGQQVCKALNAFGGEGVYAVARCCLVPR ANCSIHNTPAARAGLETHVHCHQKDHVLTGCSFHWEVEDLSVRRQPALRS RRQPGQCVGHQAASVYASCCHAPGLECKIKEHGISGPSEQVTVACEAGWT LTGCNVLPGASLTLGAYSVDNLCVARVHDTARADRTSGEATVAAAICCRS RPSAKASWVQ
    • Predicted molecular weight

      72 kDa including tags
    • Amino acids

      35 to 694
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NCBI Accession number: AAH38085.1

Associated products

  • Related Products

    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-PCSK9 antibody (ab31762)
    • Anti-6X His tag® antibody [4D11] (ab5000)
    • Anti-6X His tag® antibody (ab9108)
    • Anti-PCSK9 antibody (ab95478)

Specifications

Our Abpromise guarantee covers the use of ab167759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    ELISA

  • Form

    Lyophilized
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 94% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile deionized water to a concentration of 200 µg/ml.

General Info

  • Alternative names

    • Convertase subtilisin/kexin type 9 preproprotein
    • FH3
    • HCHOLA3
    • Hypercholesterolemia autosomal dominant 3
    • LDLCQ1
    • NARC 1
    • NARC-1
    • NARC1
    • Neural apoptosis regulated convertase 1
    • Neural apoptosis-regulated convertase 1
    • PC 9
    • PC9
    • PCSK 9
    • PCSK9
    • PCSK9_HUMAN
    • Proprotein convertase 9
    • Proprotein convertase PC9
    • Proprotein convertase subtilisin/kexin type 9
    • PSEC0052
    • Subtilisin/kexin like protease PC9
    • Subtilisin/kexin-like protease PC9
    see all
  • Function

    May be implicated in the differentiation of cortical neurons and may play a role in cholesterol homeostasis.
  • Tissue specificity

    Expressed in neuro-epithelioma, colon carcinoma, hepatic and pancreatic cell lines, and in Schwann cells.
  • Involvement in disease

    Defects in PCSK9 are the cause of familial hypercholesterolemia 3 (FH3) [MIM:603776]. FH3 inheritance is autosomal dominant.
  • Sequence similarities

    Belongs to the peptidase S8 family.
    Contains 1 peptidase S8 domain.
  • Post-translational
    modifications

    The soluble zymogen undergoes autocatalytic intramolecular processing in the endoplasmic reticulum, resulting in the cleavage of its propeptide that remains associated with the secreted enzyme.
  • Cellular localization

    Secreted.
  • Target information above from: UniProt accession Q8NBP7 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • ELISA - Recombinant mouse PCSK9 protein (ab167759)
    ELISA - Recombinant mouse PCSK9 protein (ab167759)

    Immobilized Human LDL receptor protein (ab220582) at 5 μg/mL (100 μL/well) can bind Recombinant mouse PCSK9 protein (ab167759) with a linear range of 0.078-0.313 μg/mL.

     
  • Functional Studies - Recombinant mouse PCSK9 protein (ab167759)
    Functional Studies - Recombinant mouse PCSK9 protein (ab167759)

    Immobilized Human LDL receptor protein (ab220582) at 10 μg/mL (100 μL/well) can bind ab167759 with a linear range of 0.125-1 μg/mL.

  • SDS-PAGE - Recombinant mouse PCSK9 protein (ab167759)
    SDS-PAGE - Recombinant mouse PCSK9 protein (ab167759)

    SDS-PAGE analysis of reduced ab167759 stained overnight with Coomassie Blue. The protein migrates as 17 kDa and 65 kDa under reducing (R) condition due to glycosylation and proteolytic digestion.

  • Functional Studies - Recombinant mouse PCSK9 protein (ab167759)
    Functional Studies - Recombinant mouse PCSK9 protein (ab167759)

    Loaded Recombinant human LDL Receptor protein (ab220570) on Protein A Biosensor, can bind Recombinant mouse PCSK9 protein (ab167759) with an affinity constant of 2.28 nM as determined in BLI assay.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • Datasheet download

    Download

References (2)

Publishing research using ab167759? Please let us know so that we can cite the reference in this datasheet.

ab167759 has been referenced in 2 publications.

  • Kawakami R  et al. Development of vaccine for dyslipidemia targeted to a proprotein convertase subtilisin/kexin type 9 (PCSK9) epitope in mice. PLoS One 13:e0191895 (2018). PubMed: 29438441
  • Sun H  et al. PCSK9 deficiency reduces atherosclerosis, apolipoprotein B secretion, and endothelial dysfunction. J Lipid Res 59:207-223 (2018). PubMed: 29180444

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab167759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.