Description

  • Product name

    Recombinant mouse PD1 protein (Fc Chimera)
    See all PD1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSN QTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCG AISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      25 to 167
    • Additional sequence information

      Recombinant fragment of mouse PD1 extracellular domain fused to the C-terminal Fc fusion (Mouse IgG2a).

Specifications

Our Abpromise guarantee covers the use of ab216248 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    Protein may be diluted to ≥ 100 μg/ml in PBS + glycerol and stored at -80°C.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.02% Potassium chloride, 20% Glycerol, 0.64% Sodium chloride, 79% Phosphate Buffer

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CD279
    • CD279 antigen
    • hPD 1
    • hPD l
    • hPD-1
    • hSLE1
    • PD 1
    • PD-1
    • PD1
    • PDCD 1
    • PDCD1
    • PDCD1_HUMAN
    • Programmed cell death 1
    • Programmed cell death 1 protein
    • Programmed cell death protein 1
    • Protein PD 1
    • Protein PD-1
    • SLEB2
    • Systemic lupus erythematosus susceptibility 2
    see all
  • Function

    Possible cell death inducer, in association with other factors.
  • Involvement in disease

    Genetic variation in PDCD1 is associated with susceptibility to systemic lupus erythematosus type 2 (SLEB2) [MIM:605218]. Systemic lupus erythematosus is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage

    Induced at programmed cell death.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE using 3μg of ab216248.

  • Gel filtration curve of ab216248.

References

ab216248 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216248.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up