Bioactive grade

Recombinant mouse PD1 protein (Fc Chimera) (ab221326)

Description

  • Product name

    Recombinant mouse PD1 protein (Fc Chimera)
    See all PD1 proteins and peptides
  • Biological activity

    Immobilized Mouse PD-L1, Fc Tag at 5 μg/mL (100 μL/well) can bind Mouse PD-1, mouse IgG2a Fc tag with a linear range of 0.078-0.313 μg/mL.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      SGWLLEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRL SPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGI YLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      21 to 167
    • Additional sequence information

      This protein carries a mouse IgG2a Fc tag ((Glu 98 - Lys 330; P01863) at the C-terminus (NP_032824).

Specifications

Our Abpromise guarantee covers the use of ab221326 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD279
    • CD279 antigen
    • hPD 1
    • hPD l
    • hPD-1
    • hSLE1
    • PD 1
    • PD-1
    • PD1
    • PDCD 1
    • PDCD1
    • PDCD1_HUMAN
    • Programmed cell death 1
    • Programmed cell death 1 protein
    • Programmed cell death protein 1
    • Protein PD 1
    • Protein PD-1
    • SLEB2
    • Systemic lupus erythematosus susceptibility 2
    see all
  • Function

    Possible cell death inducer, in association with other factors.
  • Involvement in disease

    Genetic variation in PDCD1 is associated with susceptibility to systemic lupus erythematosus type 2 (SLEB2) [MIM:605218]. Systemic lupus erythematosus is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage

    Induced at programmed cell death.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Mouse PD-1, mouse IgG2a Fc tag on SDS-PAGE under reducing (R) and non-reducing (NR) conditions. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 90%.
  • Immobilized Mouse PD-L2, Fc Tag at 5 µg/mL (100 µL/well) can bind Mouse PD-1, mouse IgG2a Fc tag with a linear range of 0.078-0.625 µg/mL.
  • Immobilized Mouse PD-L1, Fc Tag at 5 µg/mL (100 µL/well) can bind Mouse PD-1, mouse IgG2a Fc tag with a linear range of 0.078-0.313 µg/mL.
  • SDS-PAGE analysis of reduced (lane 1) and non-reduced (lane 2) ab221326 staining overnight with Coomassie Blue. 

    The protein migrates as 55-66 kDa under reducing conditions and 100-130 kDa under non-reducing conditions on SDS-PAGE gel.

References

ab221326 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221326.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up