Description

  • Product name

    Recombinant mouse PDE7B protein
    See all PDE7B proteins and peptides
  • Biological activity

    Specific Activity: ≥240 pmol/min/µg.

    Assay conditions: 10 mM Tris-HCl, pH 7.4, 10 mM MgCl2, 0.05% Tween-20, 0.1 mg/ml BSA, 200 µM cAMP, 2.5 kU 5'-nucleotidase, and serial dilutions of ab198479 at 37°C for 20 min. Quantified by 5'-nucleotidase cleaving the 5'-AMP product and releasing the phosphate group which is detected by Malachite Green Reagent.

  • Purity

    >= 65 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MLSKVGTWDFDIFLFDRLTNGNSLVTLLCHLFNSHGLIHHFKLDMVTLHR FLVMVQEDYHGHNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIMLGL LAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLRES RLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHNKDLRLEN VQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGDLEQKFEL EISPLCNQQKDSIPSIQIGFMTYIVEPLFREWARFTGNSTLSENMLSHLA HNKAQWKSLLSNQHRRRGSGQDLAGPAPETLEQTEGATP
    • Predicted molecular weight

      65 kDa including tags
    • Amino acids

      108 to 446
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198479 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 10% Glycerol, 0.02% Potassium chloride, 0.05% DTT, 0.55% Glutathione

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • bA472E5.1
    • cAMP specific 3 5 cyclic phosphodiesterase 7B
    • cAMP specific 3'5' cyclic phosphodiesterase 7B
    • High affinity cAMP specific 3 5 cyclic phosphodiesterase
    • High affinity cAMP specific 3'5' cyclic phosphodiesterase
    • MGC88256
    • OTTHUMP00000017267
    • PDE 7B
    • PDE7B protein
    • Phosphodiesterase 7B
    • Phosphodiesterase7B
    • RNPDE7B
    • Rolipram insensitive phosphodiesterase type 7
    see all
  • Relevance

    PDE7B is a cAMP specific phosphodiesterase. The cAMP-specific phosphodiesterase type-7 (PDE7) family is comprised of 2 genes (PDE7A and PDE7B) each with multiple splice variants generated by RNA splicing and use of alternate initiation sites. PDE7B has three splice variants (PDE7B1 = 446 amino acid; PDE7B2 =359 amino acids and PDE7B3 = 459 amino acids. Both PDE7B2 ad PDE7B3 posses unique N-terminal sequences. PDE7B is expressed in various tissues including skeletal muscle, heart, lung and testis. PDE7B may be involved in the control of cAMP-mediated neural activity and cAMP metabolism in the brain.
  • Cellular localization

    cytosol

Images

  • 10% SDS-PAGE analysis of ab198479 with Coomassie staining.

    Lane 1: 10 μg ab198479
    Lane 2: Protein marker

  • Example of specific activity of ab198479

References

ab198479 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198479.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up