Description

  • Product name

    Recombinant Mouse PDK1 protein (His tag)
    See all PDK1 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Baculovirus
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      ASASASGSGPASELGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSF MFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKD KSAEDAKTIYEFTDTVIRIRNRHNDVIPTMAQGVTEYKESFGVDPVTSQN VQYFLDRFYMSRISIRMLLNQHSLLFGGKGSPSHRKHIGSINPNCDVVEV IKDGYENARRLCDLYYVNSPELELEELNAKSPGQTIQVVYVPSHLYHMVF ELFKNAMRATMEHHADKGVYPPIQVHVTLGEEDLTVKMSDRGGGVPLRKI DRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSL EGYGTDAVIYIKALSTESVERLPVYNKAAWKHYKANHEADDWCVPSREPK DMTTFRSS
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      27 to 434
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 27 to 434. The transit peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab235012 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Mitochondrial Pyruvate dehydrogenase kinase 1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial
    • HGNC:8809
    • Mitochondrial pyruvate dehydrogenase kinase isoenzyme 1
    • PDH kinase 1
    • Pdk1
    • PDK1_HUMAN
    • Pyruvate dehydrogenase kinase isoform 1
    • Pyruvate dehydrogenase kinase, isoenzyme 1
    see all
  • Function

    Inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.
  • Tissue specificity

    Expressed predominantly in the heart.
  • Sequence similarities

    Belongs to the PDK/BCKDK protein kinase family.
    Contains 1 histidine kinase domain.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235012.

References

ab235012 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235012.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up