Recombinant Mouse PDXP protein (Tagged) (ab226443)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
Description
-
Product name
Recombinant Mouse PDXP protein (Tagged)
See all PDXP proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
MARCERLRGAALRDVLGQAQGVLFDCDGVLWNGERIVPGAPELLQRLARA GKNTLFVSNNSRRARPELALRFARLGFAGLRAEQLFSSALCAARLLRQRL SGPPDASGAVFVLGGEGLRAELRAAGLRLAGDPGEDPRVRAVLVGYDEQF SFSRLTEACAHLRDPDCLLVATDRDPWHPLSDGSRTPGTGSLAAAVETAS GRQALVVGKPSPYMFQCITEDFSVDPARTLMVGDRLETDILFGHRCGMTT VLTLTGVSSLEEAQAYLTAGQRDLVPHYYVESIADLMEGLED -
Predicted molecular weight
48 kDa including tags -
Amino acids
1 to 292 -
Tags
His tag N-Terminus -
Additional sequence information
6xHis-SUMO tag at the N-terminus.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab226443 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
LC-MS/MS -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.2
Constituents: 50% Glycerol (glycerin, glycerine), Tris buffer
General Info
-
Alternative names
- Chronophin
- CIN
- Pdxp
see all -
Function
Protein serine phosphatase that dephosphorylates 'Ser-3' in cofilin and probably also dephosphorylates phospho-serine residues in DSTN. Regulates cofilin-dependent actin cytoskeleton reorganization. Required for normal progress through mitosis and normal cytokinesis. Does not dephosphorylate phospho-threonines in LIMK1. Does not dephosphorylate peptides containing phospho-tyrosine. Pyridoxal phosphate phosphatase. Has some activity towards pyridoxal 5'-phosphate (PLP), pyridoxine 5'-phosphate (PMP) and pyridoxine 5'-phosphate (PNP), with a highest activity with PLP followed by PNP. -
Tissue specificity
Ubiquitous. Highly expressed in all the regions of central nerve system except the spinal cord. Also expressed at high level in liver and testis. In fetus, it is weakly expressed in all organs except brain. -
Sequence similarities
Belongs to the HAD-like hydrolase superfamily. -
Cellular localization
Cytoplasm, cytosol. Cytoplasm, cytoskeleton. Cell projection, ruffle membrane. Cell projection, lamellipodium membrane. Cell membrane. Colocalizes with the actin cytoskeleton in membrane ruffles and lamellipodia. Diffusely distributed throughout the cytosol during pro-metaphase and metaphase. Detected at the dynamic cell poles during telophase. Detected at the cleavage furrow and contractile ring during cytokinesis. Transiently detected at the plasma membrane in late stages of cytokinesis. Detected at the midbody. - Information by UniProt
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226443 with 5% enrichment gel and 15% separation gel.
-
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab226443 could indicate that this peptide derived from E.coli-expressed mouse PDXP.
-
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab226443 could indicate that this peptide derived from E.coli-expressed mouse PDXP.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab226443 has not yet been referenced specifically in any publications.